DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and CAM1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:43/232 - (18%)
Similarity:92/232 - (39%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPS-LKIDGHTLCDSVAIIHYL 108
            :|..|..:...|:|        :|.|:..|..:::....|::|||: :...|:.|.:::||.:||
Yeast    14 TWVPRGLVKALKLD--------VKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYYL 70

  Fly   109 ----EETRPQPALLPQDPVKRAKIR----------EIVELICSGIQPLQNVSVLDHIGKDQSLQW 159
                ::.:.:..||..|....|:.:          ::...|.:.|.||:..:..:....|.::  
Yeast    71 VKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAM-- 133

  Fly   160 AQHWISRGFQGLEKVLSHSAGK-----FCVGDELSMADICLVPQVRNARRYKADL------TPYP 213
                     ..::|::.....:     :...:.:|:||:......   .||...|      ..:|
Yeast   134 ---------DAVDKIVDIFENRLKNYTYLATENISLADLVAASIF---TRYFESLFGTEWRAQHP 186

  Fly   214 TIVRLNQELQE----LDVFKATHPSTQPDCPPEFAKK 246
            .|||....::.    .|.:|....:.:|..||:..|:
Yeast   187 AIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQKKKE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 17/68 (25%)
maiA 35..240 CDD:273527 40/224 (18%)
GST_C_Zeta 122..236 CDD:198300 19/138 (14%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 17/66 (26%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 19/135 (14%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.