DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GTT1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:46/209 - (22%)
Similarity:87/209 - (41%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PILYSYW-PSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKI-DGH 96
            ||:..:| ..|.::|:...|....::|:|.|   .|..:......|.::::|:.:.|.|:: |..
Yeast     4 PIIKVHWLDHSRAFRLLWLLDHLNLEYEIVP---YKRDANFRAPPELKKIHPLGRSPLLEVQDRE 65

  Fly    97 T-----LCDSVAIIHY-LEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQ 155
            |     |.:|..|..| |:.......|:.:|.....:|...:..:...:||...:..:....||.
Yeast    66 TGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDS 130

  Fly   156 SLQWAQHWISR-----------------GFQGLEKVLSHSAGKFCVGDELSMADICL-VP-QVRN 201
            .:.:...:::|                 .|..:|..:|.:.| :.|..:||.|||.: .| |:..
Yeast   131 GMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNG-YLVDGKLSGADILMSFPLQMAF 194

  Fly   202 ARRYKADLTPYPTI 215
            .|::.|. ..||.|
Yeast   195 ERKFAAP-EDYPAI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 20/82 (24%)
maiA 35..240 CDD:273527 45/208 (22%)
GST_C_Zeta 122..236 CDD:198300 23/113 (20%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 19/83 (23%)
GST_C_GTT1_like 93..218 CDD:198298 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.