DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and TEF4

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:40/181 - (22%)
Similarity:65/181 - (35%) Gaps:56/181 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TDEYREVNPMQKVPS-LKIDGHTLCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGI 139
            :.|:..:.|:::.|: |...|..|.:::||..||..   |.|    |..:||:      |:.|  
Yeast    36 SSEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLAN---QVA----DEKERAR------LLGS-- 85

  Fly   140 QPLQNVSVLDHIGKDQSLQWA-------QHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVP 197
                     |.|.|.|.|:||       ...|:|.|...:.::.::.         ...|.|.|.
Yeast    86 ---------DVIEKSQILRWASLANSDVMSNIARPFLSFKGLIPYNK---------KDVDACFVK 132

  Fly   198 QVRNARRYKADLTPYPTIVRLNQELQELDV---------------FKATHP 233
            ....|..:.|.|..|..:...|..|.:|..               ::|.||
Yeast   133 IDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 9/33 (27%)
maiA 35..240 CDD:273527 40/181 (22%)
GST_C_Zeta 122..236 CDD:198300 27/134 (20%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 10/38 (26%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 21/104 (20%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.