DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GTT2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:61/237 - (25%)
Similarity:88/237 - (37%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KPILYSYWPSSCSWRVRVALAIKKIDYDI-------------KPTSLLKTVSGHAYTDEYREVNP 84
            |.|:|.........|||:|||.|.:...:             ||..|.|..||            
Yeast    18 KMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSG------------ 70

  Fly    85 MQKVPSLKIDGHTL-CDSVAIIHYLEETRPQPALLPQDPVKRAKI-----REIVELICSGIQPLQ 143
              .||.|::|..|| .:..||..|::.....|.|..:.|:::..|     |..:||       |.
Yeast    71 --TVPVLELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELEL-------LD 126

  Fly   144 NVSVLDH-----IGKDQSLQWAQHWISRGFQGLEKVLSHSAGKF---------CVGDELSMADIC 194
            .|||..|     :|.:..|...:.|   |.:..:|.| |....|         ..||..|||||.
Yeast   127 PVSVYFHHATPGLGPEVELYQNKEW---GLRQRDKAL-HGMHYFDTVLRERPYVAGDSFSMADIT 187

  Fly   195 LVPQVRNARRYKADLTPYPTIVRLNQELQELDVFKATHPSTQ 236
            ::          |.|. :..||:| |..:|.:..:|.:...|
Yeast   188 VI----------AGLI-FAAIVKL-QVPEECEALRAWYKRMQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 24/88 (27%)
maiA 35..240 CDD:273527 60/235 (26%)
GST_C_Zeta 122..236 CDD:198300 33/132 (25%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 24/88 (27%)
GST_C_GTT2_like 106..222 CDD:198291 34/135 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.