DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and AT3G47680

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:194 Identity:39/194 - (20%)
Similarity:64/194 - (32%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETRP--------QPALLPQDPVKRAKIR---- 129
            |.|...:....:.:.:.:.|.|           ||.|        |.|..|:  |||.:.:    
plant     2 DPYSHGSSFMNLLTSQQEAHNL-----------ETNPYDDDVSPNQAAHTPK--VKRERRKWSAG 53

  Fly   130 EIVELICSGIQPLQNVSVLDHIGKDQS--LQW----AQHWISRGFQGLEK-----------VLSH 177
            |.:.|:.:.:    |.|....||.:|.  ..|    |.:..|....|:||           .::.
plant    54 EDLVLVSAWL----NTSKDAVIGNEQKGYAFWSRIAAYYGASPKLNGVEKRETGHIKQRWTKINE 114

  Fly   178 SAGKFCVGDELSMAD----------ICLVPQVRNARRYKADLTPYPTIVRLNQELQELDVFKAT 231
            ..|||....|.:...          :.|..::.|:...|..|.....::|..|:.......|||
plant   115 GVGKFVGSYEAATKQKSSGQNDDDVVALAHEIYNSEHGKFTLEHAWRVLRFEQKWLSAPSTKAT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 4/31 (13%)
maiA 35..240 CDD:273527 39/194 (20%)
GST_C_Zeta 122..236 CDD:198300 29/141 (21%)
AT3G47680NP_190352.1 NAM-associated 153..>274 CDD:373005 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42673
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.