DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GSTZ2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_178343.1 Gene:GSTZ2 / 814769 AraportID:AT2G02380 Length:223 Species:Arabidopsis thaliana


Alignment Length:211 Identity:87/211 - (41%)
Similarity:128/211 - (60%) Gaps:10/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLC- 99
            |||||.|||:.|||:||.:|.:||:..|.:|||   |.....:::::|||..||:| :||..:. 
plant    14 LYSYWRSSCAHRVRIALTLKGLDYEYIPVNLLK---GDQSDSDFKKINPMGTVPAL-VDGDVVIN 74

  Fly   100 DSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVL----DHIGKDQSLQWA 160
            ||.|||.||::..|:|.|||.|..|||...:...::.|||||.||:::.    |.|..::...|.
plant    75 DSFAIIMYLDDKYPEPPLLPSDYHKRAVNYQATSIVMSGIQPHQNMALFRYLEDKINAEEKTAWI 139

  Fly   161 QHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNA-RRYKADLTPYPTIVRLNQELQE 224
            .:.|::||..|||:|...|||:..|||:.:||:.|.||:..| .|:..::.|:||:.|..:...|
plant   140 TNAITKGFTALEKLLVSCAGKYATGDEVYLADLFLAPQIHAAFNRFHINMEPFPTLARFYESYNE 204

  Fly   225 LDVFKATHPSTQPDCP 240
            |..|:...|..|||.|
plant   205 LPAFQNAVPEKQPDTP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 35/73 (48%)
maiA 35..240 CDD:273527 86/209 (41%)
GST_C_Zeta 122..236 CDD:198300 41/118 (35%)
GSTZ2NP_178343.1 GST_N_Zeta 12..84 CDD:239340 35/73 (48%)
maiA 13..220 CDD:273527 86/209 (41%)
GST_C_Zeta 98..216 CDD:198300 41/117 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3089
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7747
Inparanoid 1 1.050 183 1.000 Inparanoid score I1427
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - mtm1023
orthoMCL 1 0.900 - - OOG6_103004
Panther 1 1.100 - - O PTHR42673
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1983
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.