DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:204 Identity:41/204 - (20%)
Similarity:79/204 - (38%) Gaps:72/204 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYRE-----VNPMQKVPSLKID 94
            :||.:..|..|.:||:.:|.|.:..:.:..||.::        |::|     :|..::||.:...
Human    48 VLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQS--------EHKEPWFMRLNLGEEVPVIIHR 104

  Fly    95 GHTLCDSVAIIHYLEET-------------RPQPALLPQDPV----------KRAKI---REIV- 132
            .:.:.|...||.|:|.|             ..||..:|.:.|          :.|::   ||:: 
Human   105 DNIISDYDQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGSLQHARVLQYRELLD 169

  Fly   133 ---------------ELICSGIQP----------LQNVSV----LDHIGKDQSLQWAQHWISRGF 168
                           ||....:.|          |.|.:.    |||   ::..|.::.::|:..
Human   170 ALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDH---EEEPQLSEPYLSKQK 231

  Fly   169 QGLEKVLSH 177
            :.:.|:|.|
Human   232 KLMAKILEH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 19/78 (24%)
maiA 35..240 CDD:273527 41/204 (20%)
GST_C_Zeta 122..236 CDD:198300 17/99 (17%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 41/204 (20%)
GST_N_GDAP1 47..119 CDD:239350 19/78 (24%)
GST_C_GDAP1L1 220..330 CDD:198335 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.