DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and Gstt4

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:160 Identity:46/160 - (28%)
Similarity:70/160 - (43%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETRPQPA-LLPQ 120
            |.:|.:...|||   ||.::.||.|:||::|||||:.....|.:||||:.||......|: ..|.
  Rat    26 IPFDFQFVDLLK---GHHHSKEYIEINPLRKVPSLRDGKFILSESVAILCYLCRKYSAPSHWYPP 87

  Fly   121 DPVKRAKIREIVELICSGIQ-PLQNV---------------------SVLDHIGKDQSLQWAQHW 163
            |...||::.|.:....:.|| |:..:                     ..||.:.|:         
  Rat    88 DLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTERLDKTLDEVNKN--------- 143

  Fly   164 ISRGFQGLEKVLSHSAGKFCVGDELSMADI 193
             .:.|:  ||.|....  |..||.:|:||:
  Rat   144 -IKQFE--EKFLQDKL--FITGDHISLADL 168

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/51 (45%)
maiA 35..240 CDD:273527 46/160 (29%)
GST_C_Zeta 122..236 CDD:198300 19/94 (20%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 24/54 (44%)