DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GSTT2B

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:196 Identity:45/196 - (22%)
Similarity:77/196 - (39%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFRHLATKPILYSYWPSSCSWRVRVALAIKK--IDYDIKPTSLLKTVSGHAYTDEYREVNPMQKV 88
            ||..|.::|....|            :..||  |..:::...|:|   |...:.|:.::|.:.|:
Human     5 LFLDLVSQPSRAVY------------IFAKKNGIPLELRTVDLVK---GQHKSKEFLQINSLGKL 54

  Fly    89 PSLKIDGHTLCDSVAIIHYLEETRPQP-ALLPQDPVKRAKIREI-------------VELICSGI 139
            |:||.....|.:|.||:.||......| ...|.|...||::.|.             :.|....:
Human    55 PTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVL 119

  Fly   140 QPLQNVSV------LDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQ 198
            .||..|.|      .:....||:|||.:          :|.|...  .|..|.::::||:..:.:
Human   120 GPLIGVQVPEEKVERNRTAMDQALQWLE----------DKFLGDR--PFLAGQQVTLADLMALEE 172

  Fly   199 V 199
            :
Human   173 L 173

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 19/76 (25%)
maiA 35..240 CDD:273527 41/187 (22%)
GST_C_Zeta 122..236 CDD:198300 19/97 (20%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 23/87 (26%)