DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstD10

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:202 Identity:47/202 - (23%)
Similarity:80/202 - (39%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCD 100
            || |.|.|...| .|.:..|.:..:....:::.|.:...:|.||.::||...:|:|...|..|.:
  Fly     3 LY-YRPGSAPCR-SVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Fly   101 SVAIIHYL-EETRPQPALLPQDPVKRAKIRE--------IVELICSGIQP---LQNVSVLDHIGK 153
            |.||:.|| |:......|.|:|..|:|.|.:        :.:.......|   |:..:..::..|
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKK 130

  Fly   154 DQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVRL 218
                      |...|:.|...|....  :..|.:.|:|||..:..|........|...|..:.|.
  Fly   131 ----------IEVAFEFLNTFLEGQT--YSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARW 183

  Fly   219 NQELQEL 225
            .:..::|
  Fly   184 YENAKKL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/73 (32%)
maiA 35..240 CDD:273527 47/202 (23%)
GST_C_Zeta 122..236 CDD:198300 20/115 (17%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 23/73 (32%)
PLN02473 3..196 CDD:166114 47/202 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 20/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.