DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and eef1e1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:169 Identity:33/169 - (19%)
Similarity:62/169 - (36%) Gaps:52/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 REVNPMQ-----------------KVPSLK-IDGHTLCDSVAIIHYLEETRPQPALLPQDPVKRA 126
            ||:|.::                 |||.|: .:|..|...|.|..:|.:...:|.||..|..:||
Zfish     4 RELNSLERFLGLKKANKYSTQGGKKVPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDDAEQRA 68

  Fly   127 KIREIVELICSGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMA 191
            .:::.:|         ..::.||:..|::        :....:.|.:.|....  :..|:..::|
Zfish    69 VVQQWLE---------HRITKLDNCSKEE--------VKVILKDLNRYLEDKV--YLAGNVFTLA 114

  Fly   192 DICLVPQVR---------------NARRYKADLTPYPTI 215
            ||.:...:.               |..|:...:..||.|
Zfish   115 DILMYYGIHHIIVELAIQEKECYLNVSRWFDHIQHYPGI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 11/46 (24%)
maiA 35..240 CDD:273527 33/169 (20%)
GST_C_Zeta 122..236 CDD:198300 17/109 (16%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 17/109 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.