DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and gstt1a

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:174 Identity:44/174 - (25%)
Similarity:74/174 - (42%) Gaps:50/174 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETRPQP-AL 117
            |.||.::.|...|   .:|..|.||:.:|:.::|||:||.....|.:|:||:.||......| ..
Zfish    23 INKIPFEYKAVDL---SAGEQYGDEFGKVSIIRKVPALKDGDFLLTESIAILLYLAGKHSTPDHW 84

  Fly   118 LPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGL----------- 171
            .|.|..|||::.|.:.        .|:.::..|..|   :.|        |:|:           
Zfish    85 YPADLQKRAQVDEFLS--------WQHTNIRSHGSK---VFW--------FKGVLPAVTGAPVPK 130

  Fly   172 EKVLSH----------------SAGKFCVGDELSMADICLVPQV 199
            ||:.|.                .:..|.:||::|:|||..:.::
Zfish   131 EKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 20/54 (37%)
maiA 35..240 CDD:273527 44/174 (25%)
GST_C_Zeta 122..236 CDD:198300 20/105 (19%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 44/174 (25%)
GST_N_Theta 3..78 CDD:239348 21/57 (37%)
GST_C_Theta 91..217 CDD:198292 20/103 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.