DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and gdap1l1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:254 Identity:52/254 - (20%)
Similarity:92/254 - (36%) Gaps:90/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTL- 98
            :||.:..|..|.:||:.:..|.:..:.:..||..|.....:   :..:|..::|| :.|.|.|: 
Zfish    49 VLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPW---FMRLNLGEEVP-VFIHGDTIV 109

  Fly    99 CDSVAIIHYLE-----ETRPQPALLPQD--PV--KRAKIREIV----------------ELICSG 138
            .|...||.|:|     :|..|  |:|.:  |:  :..:.||::                ||....
Zfish   110 SDYNQIIDYIETNFVGDTVAQ--LIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDS 172

  Fly   139 IQP----------LQNVS----VLDHIGKDQSLQWAQHWISRGFQGLEKVLSHS----------- 178
            :.|          |.|.:    .|||    :..|..:.::|:..:.:.|:|.|.           
Zfish   173 MIPKYATAEIRRHLANAASELMKLDH----EEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGE 233

  Fly   179 -------------------AGKFC----VGDELSMADICLVPQVRN------ARRYKAD 208
                               .|:.|    .|...::|||||...:..      :|:|..|
Zfish   234 LAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWED 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 20/74 (27%)
maiA 35..240 CDD:273527 52/254 (20%)
GST_C_Zeta 122..236 CDD:198300 27/159 (17%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 52/254 (20%)
Thioredoxin_like 48..120 CDD:294274 20/74 (27%)
GST_C_GDAP1L1 201..311 CDD:198335 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.