Sequence 1: | NP_649894.1 | Gene: | GstZ1 / 41132 | FlyBaseID: | FBgn0037696 | Length: | 246 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 254 | Identity: | 52/254 - (20%) |
---|---|---|---|
Similarity: | 92/254 - (36%) | Gaps: | 90/254 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 ILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTL- 98
Fly 99 CDSVAIIHYLE-----ETRPQPALLPQD--PV--KRAKIREIV----------------ELICSG 138
Fly 139 IQP----------LQNVS----VLDHIGKDQSLQWAQHWISRGFQGLEKVLSHS----------- 178
Fly 179 -------------------AGKFC----VGDELSMADICLVPQVRN------ARRYKAD 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstZ1 | NP_649894.1 | GST_N_Zeta | 34..109 | CDD:239340 | 20/74 (27%) |
maiA | 35..240 | CDD:273527 | 52/254 (20%) | ||
GST_C_Zeta | 122..236 | CDD:198300 | 27/159 (17%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 52/254 (20%) |
Thioredoxin_like | 48..120 | CDD:294274 | 20/74 (27%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 16/92 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1283865at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |