DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and Gstt3

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:175 Identity:49/175 - (28%)
Similarity:75/175 - (42%) Gaps:42/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VALAIKK--IDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETR 112
            |.:..||  |.:.::...|||   |..|||.:.:|||::|||:||.....|.:||||:.||....
  Rat    74 VYIFAKKNGIPFQLRTIELLK---GQHYTDAFAQVNPLRKVPALKDGDFVLAESVAILLYLSRKY 135

  Fly   113 PQP-ALLPQDPVKRAKIRE-------IVELICS---------------GIQPLQNVSVLDHIGKD 154
            ..| ...|||...||::.|       .:...||               .:.|.:..|.|..:  |
  Rat   136 KAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQPVPPERLASTLAEL--D 198

  Fly   155 QSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQV 199
            ..||..:          :|.|.:.|  |..|..:|:||:..:.::
  Rat   199 GCLQMLE----------DKFLQNKA--FLTGPHISVADLVAITEL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 25/60 (42%)
maiA 35..240 CDD:273527 49/175 (28%)
GST_C_Zeta 122..236 CDD:198300 19/100 (19%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 26/63 (41%)
GST_C_Theta 149..273 CDD:198292 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.