DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:201 Identity:46/201 - (22%)
Similarity:81/201 - (40%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSWSKPLFRHLATKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNP 84
            ||....|:..|.::|....|          :.....:|.::.....|||  :|...|.|:.:|:.
 Frog     2 SSSELTLYLDLLSQPCRSVY----------IFAKANRIPFNYCKLQLLK--AGEHLTQEFGKVSV 54

  Fly    85 MQKVPSLKIDGHTLCDSVAIIHYLEETRPQP-ALLPQDPVKRAKIREIVELICSGIQPLQNVSVL 148
            :.|||:||....|:.:|.|::.||......| ...|.|..|||::.|.:        ..|:.:..
 Frog    55 LHKVPALKDGNFTMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYL--------AWQHTNTR 111

  Fly   149 DH--------------IGKDQSLQWAQHWIS------RGFQGLEKVLSHSAGKFCVGDELSMADI 193
            .|              :||:...:.....::      ..|:  ||.|.:.  .|..|||:|:||:
 Frog   112 PHGSKVFWTKCVSPTILGKEVPSEKMNAVMAEFVTTMNNFE--EKFLGNK--PFIAGDEISVADL 172

  Fly   194 CLVPQV 199
            ..:.::
 Frog   173 VAIVEI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 19/74 (26%)
maiA 35..240 CDD:273527 41/186 (22%)
GST_C_Zeta 122..236 CDD:198300 19/98 (19%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 22/87 (25%)
GST_C_Theta 95..221 CDD:198292 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.