DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstD7

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:188 Identity:48/188 - (25%)
Similarity:85/188 - (45%) Gaps:14/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCD 100
            ||:: |.:.:.|. :.:..|.:..::. :.|:.|:.|.....|:..:||...:|:|..:|..:.:
  Fly     6 LYNF-PMAPASRA-IQMVAKALGLELN-SKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWE 67

  Fly   101 SVAIIHYLEET--RPQPALLPQDPVKRAKIREIVELICSGIQP--LQNVSVLDHIGK--DQSLQW 159
            |.||..||.|.  :|...|.|.||.|||.|.:.:......:..  .:...::...||  ||.   
  Fly    68 SRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE--- 129

  Fly   160 AQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVR 217
            |...::..|..|...|  ....|..|.:|::|||.::..|.....:..||:.:|.:.|
  Fly   130 ALDKVNSAFGFLNTFL--EGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVER 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 18/72 (25%)
maiA 35..240 CDD:273527 48/188 (26%)
GST_C_Zeta 122..236 CDD:198300 24/100 (24%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/73 (26%)
GstA 6..188 CDD:223698 48/188 (26%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460379
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.