DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstD5

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:195 Identity:49/195 - (25%)
Similarity:81/195 - (41%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCDS 101
            ||...|.|...:.||.|: .:..::|   ||.|:.......|:.::||...:|:|..:|.::.:|
  Fly     5 YSPRGSGCRTVIMVAKAL-GVKLNMK---LLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly   102 VAIIHYL-EETRPQPALLPQDPVKRAKIRE--------IVELICSGIQPLQNVSVLDHIGKDQSL 157
            .||..|| |:......|.|:||.|:|.:.:        :.:.......|      |.|.||..| 
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYP------LFHTGKPGS- 123

  Fly   158 QWAQHWISRGFQGLEKVLSH-----SAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVR 217
                   ...|:.:|....:     ....:..||.|::|||.::..|.....:..||..||.:.|
  Fly   124 -------DEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVAR 181

  Fly   218  217
              Fly   182  181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 22/72 (31%)
maiA 35..240 CDD:273527 49/195 (25%)
GST_C_Zeta 122..236 CDD:198300 23/109 (21%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/195 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.