DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstZ2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:214 Identity:143/214 - (66%)
Similarity:178/214 - (83%) Gaps:1/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHT 97
            :|||||||.||||||||:|:.:|:|.|||||.||:|: .|..:.:||||||||::||:|:|||||
  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKS-GGEQHCNEYREVNPMEQVPALQIDGHT 78

  Fly    98 LCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQWAQH 162
            |.:||||:|||||||||..|||||..||||:|||||:||||||||||:.||.|:|:::..:||||
  Fly    79 LIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQH 143

  Fly   163 WISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVRLNQELQELDV 227
            ||:|||:.:||.||.||||:|||||:||||.||||||.||||:..||.|||.|:|:::||:....
  Fly   144 WITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPA 208

  Fly   228 FKATHPSTQPDCPPEFAKK 246
            |:|.|||.|||||||...|
  Fly   209 FRAAHPSNQPDCPPELPNK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 50/74 (68%)
maiA 35..240 CDD:273527 137/204 (67%)
GST_C_Zeta 122..236 CDD:198300 73/113 (65%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 50/74 (68%)
maiA 17..221 CDD:273527 137/204 (67%)
GST_C_Zeta 104..217 CDD:198300 73/112 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442267
Domainoid 1 1.000 77 1.000 Domainoid score I3089
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I1427
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - otm25879
orthoMCL 1 0.900 - - OOG6_103004
Panther 1 1.100 - - P PTHR42673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1983
1211.810

Return to query results.
Submit another query.