DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and gfzf

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:88/222 - (39%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLCD 100
            ||:......|..||:.|....|.|.:.....  ....|. ::||.::||.:::|.|..||..|.:
  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDF--CAMEHR-SEEYSKMNPQKEIPVLDDDGFYLSE 875

  Fly   101 SVAIIHYL-EETRPQPALLPQDPVKRAKIREIVELICSGI----QPLQNVSV----LDHIGKDQS 156
            |:||:.|| ::..|...|.|||...||.|.   :.:|..:    .|:...|:    .|:.....|
  Fly   876 SIAIMQYLCDKYAPDSTLYPQDVNVRAVIN---QRLCFNMGFYYAPISAHSMAPIFFDYKRTPMS 937

  Fly   157 LQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADL------------ 209
            |:..|:    .....|..|.....|:..|:.:::||..|:...........||            
  Fly   938 LKKVQN----ALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYET 998

  Fly   210 --TPYPTIVRL-NQELQELDVFKATHP 233
              ..||.:..: |..:||:..|:...|
  Fly   999 FKVEYPQLWEIANSGMQEISAFEQNPP 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/73 (32%)
maiA 35..240 CDD:273527 54/222 (24%)
GST_C_Zeta 122..236 CDD:198300 26/135 (19%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 23/74 (31%)
GstA 812..1000 CDD:223698 47/195 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 23/123 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.