DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and se

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:85/218 - (38%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RHLAT-KPI----------LYSYWPSSCSWRVRVALAIKKIDYDI-------KPTSLLKTVSGHA 74
            ||||. .|:          |||......:.||.:.|..|:|.|..       ||..||       
  Fly     5 RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLL------- 62

  Fly    75 YTDEYREVNPMQKVPSLKI----DGHTLCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELI 135
                  |.||..|||:|:|    ....|.:|:.|..||:|..|...|.|:||:|:.:.:.::|..
  Fly    63 ------EKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERF 121

  Fly   136 CSGIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVP--- 197
            .:.:......|    .|.|....|:      |....|:.|:....:|..|::..:.|..:.|   
  Fly   122 RAVLGAFFKAS----DGGDLEPFWS------GLDIYERELARRGTEFFGGEQTGILDYMIWPWCE 176

  Fly   198 -----QVRNARRYKADLTPYPTI 215
                 :::....|..|.:.:|.:
  Fly   177 RLELLKLQRGEDYNYDQSRFPQL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 26/95 (27%)
maiA 35..240 CDD:273527 48/210 (23%)
GST_C_Zeta 122..236 CDD:198300 17/102 (17%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 30/102 (29%)
GstA 22..215 CDD:223698 48/201 (24%)
GST_C_Omega 109..229 CDD:198293 16/101 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.