DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstE2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:213 Identity:53/213 - (24%)
Similarity:91/213 - (42%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LATKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKID 94
            ::.|.:||....|......::.|....:||:.|...||   :|..:.|.:.:.||...||.|:.:
  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLL---AGDHFKDAFLKKNPQHTVPLLEDN 62

  Fly    95 GHTLCDSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVELICSGI-QPLQNVSV---------- 147
            |..:.||.||:.|| ::......|.|:|.|.||::.:.:....|.: ..|:|||:          
  Fly    63 GALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLV 127

  Fly   148 ----LDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRN-ARRYKA 207
                :|:| ||            .:..||..|..:  .:..|.:|::||:|......: |.....
  Fly   128 PKEKVDNI-KD------------AYGHLENFLGDN--PYLTGSQLTIADLCCGATASSLAAVLDL 177

  Fly   208 DLTPYPTIVRLNQELQEL 225
            |...||.:....:.|.:|
  Fly   178 DELKYPKVAAWFERLSKL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/75 (31%)
maiA 35..240 CDD:273527 52/208 (25%)
GST_C_Zeta 122..236 CDD:198300 26/120 (22%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 52/209 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/75 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.