DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstE1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:213 Identity:58/213 - (27%)
Similarity:91/213 - (42%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHTLC 99
            :||....|.|...|::.|.:..:||:.|..:|   .:|...::||.:.||...||.|..:|..:.
  Fly     7 VLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNL---QAGEHLSEEYVKKNPQHTVPMLDDNGTFIW 68

  Fly   100 DSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVELICSGI-QPLQNVSVLDHIGKDQSLQWAQH 162
            ||.||..|| ::......|.|:|..|||.:.:.:....|.| ..:.|||             ...
  Fly    69 DSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVS-------------RPF 120

  Fly   163 WIS--------------RGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTP-- 211
            ||:              :|.:.||..|.:|  .:..||.|::||:...|.| :|.....|:.|  
  Fly   121 WINGVTEVPQEKLDAVHQGLKLLETFLGNS--PYLAGDSLTLADLSTGPTV-SAVPAAVDIDPAT 182

  Fly   212 YPTIVRLNQELQELDVFK 229
            ||.:......|.:|..:|
  Fly   183 YPKVTAWLDRLNKLPYYK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 25/74 (34%)
maiA 35..240 CDD:273527 58/213 (27%)
GST_C_Zeta 122..236 CDD:198300 30/125 (24%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 25/74 (34%)
GstA 8..197 CDD:223698 56/207 (27%)
GST_C_Delta_Epsilon 94..210 CDD:198287 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.