DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstE14

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:215 Identity:57/215 - (26%)
Similarity:94/215 - (43%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KPILYSYWPSSCSWRVRVALAIKK---IDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKID 94
            |||||.   ...|..||..|.:.|   ||.:::..:|.|   |..:..::..:||...||:|...
  Fly     5 KPILYY---DERSPPVRSCLMLIKLLDIDVELRFVNLFK---GEQFQKDFLALNPQHSVPTLVHG 63

  Fly    95 GHTLCDSVAI-IHYLEETRPQPALLPQDPVKRAKIREIVELICSGI-------------QPLQNV 145
            ...|.||.|| ||..|:.....:|.||:..:|.|:..::...||.:             |...||
  Fly    64 DLVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANV 128

  Fly   146 SVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLT 210
            .|..|..|          ::..:..:|:.|.:|  .|..|.:|::||:.:|..:... .....|:
  Fly   129 DVAHHERK----------LTEAYIIMERYLENS--DFMAGPQLTLADLSIVTTLSTV-NLMFPLS 180

  Fly   211 PYPTIVRLNQELQELDVFKA 230
            .:|.:.|....:|:||.::|
  Fly   181 QFPRLRRWFTAMQQLDAYEA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 26/78 (33%)
maiA 35..240 CDD:273527 55/213 (26%)
GST_C_Zeta 122..236 CDD:198300 26/122 (21%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 55/212 (26%)
GST_N_Delta_Epsilon 6..79 CDD:239343 26/78 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.