DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and Clic

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:192 Identity:45/192 - (23%)
Similarity:77/192 - (40%) Gaps:44/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LKTVSGHAYTDEYREVNPMQKV------PSLKID-GHTLCDSVAIIHYLEETRPQP-ALLPQDPV 123
            |||:|....|.:.::..|..:.      |.:.|| |..:.::..|..::.:..|.. .|..||  
  Fly    56 LKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQD-- 118

  Fly   124 KRAKIREIVELICSGIQPLQNVSV---LDHIGKDQSLQWA--QHWISRGFQGLEKVLSHSAG--- 180
                 :|:..||       :|:.|   |..:.||::...|  .|        |.|:..|.:.   
  Fly   119 -----KEVATLI-------ENLYVKLKLMLVKKDEAKNNALLSH--------LRKINDHLSARNT 163

  Fly   181 KFCVGDELSMADICLVPQ---VRNARRYKADL---TPYPTIVRLNQELQELDVFKATHPSTQ 236
            :|..||.:...|..|:|:   :|.|.:|..|.   |....:.|....:.:||.|..:.|:.|
  Fly   164 RFLTGDTMCCFDCELMPRLQHIRVAGKYFVDFEIPTHLTALWRYMYHMYQLDAFTQSCPADQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 11/48 (23%)
maiA 35..240 CDD:273527 45/192 (23%)
GST_C_Zeta 122..236 CDD:198300 29/127 (23%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 12/55 (22%)
O-ClC 21..231 CDD:129941 45/192 (23%)
GST_C_CLIC 118..232 CDD:198307 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.