DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstT4

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:191 Identity:49/191 - (25%)
Similarity:90/191 - (47%) Gaps:24/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VALAIKKIDYDIKPTSLLKTVSGHAYTDEYRE-VNPMQKVPSLKIDGHTLCDSVAIIHYLEETRP 113
            :.|...||.::..|.|:||   |...|.|:|: ||..:|:|::...|:.|.::|||..:|...:.
  Fly    21 ILLEASKIPFEAIPISMLK---GEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKL 82

  Fly   114 QPA-LLPQDPVKRAKIREIV-----ELICSGIQPLQNVSVLDHIGK----DQSLQWAQHWISRGF 168
            .|. ..|:..:.|::|.|.:     .:..:..:..|...::.::.|    |.::..|...:....
  Fly    83 VPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTL 147

  Fly   169 QGLEKVLSHSAGKFCVGDELSMAD---ICLVPQVR----NARRYKADLTPYPTIVRLNQEL 222
            ...|::..:|. ||.:||.:|.||   ||.:.|.:    ||.:.:..|..:...||  :||
  Fly   148 NEFEQLFLNSR-KFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVR--EEL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 20/59 (34%)
maiA 35..240 CDD:273527 49/191 (26%)
GST_C_Zeta 122..236 CDD:198300 26/117 (22%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/61 (34%)
GST_C_Theta 95..220 CDD:198292 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459994
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.