DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and GstT2

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:89/218 - (40%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SKPL-FRHLATKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQ 86
            |||: |.:....||....|         :.|.......:..|.:|.|.   ...||||:::|..|
  Fly     2 SKPIRFYYDLLSPIARGLW---------IGLKFSNSPVEYCPIALRKF---EQLTDEYKKINRFQ 54

  Fly    87 KVPSLKIDGHTLCDSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVE-------LICS------ 137
            |||::......|.:::|||.|| ::.:....|.|:....||::.|.:|       |.||      
  Fly    55 KVPAIVGGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDA 119

  Fly   138 ------GIQPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLV 196
                  ||.|..         |.:.:|.....:......||::...:  .|.||..|:||||...
  Fly   120 WLFPMNGIAPKP---------KPEQIQALIEGVENNLGLLERLWLEN--DFLVGKNLTMADILGS 173

  Fly   197 PQVRNAR--RYKADLTPYPTIVR 217
            .::...|  :|:.|...:|.:|:
  Fly   174 SEINQLRLCQYRVDEKKFPKVVK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 22/75 (29%)
maiA 35..240 CDD:273527 50/205 (24%)
GST_C_Zeta 122..236 CDD:198300 27/117 (23%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/86 (27%)
GstA 7..202 CDD:223698 52/213 (24%)
GST_C_family 93..218 CDD:295467 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.