DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and EEF1G

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001395.1 Gene:EEF1G / 1937 HGNCID:3213 Length:437 Species:Homo sapiens


Alignment Length:240 Identity:57/240 - (23%)
Similarity:92/240 - (38%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAY------TDEYREVNPMQKVPSLK-I 93
            ||:| |.  :||...||...:  |......:| :...|.:      |.|:....|..|||:.: .
Human     6 LYTY-PE--NWRAFKALIAAQ--YSGAQVRVL-SAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGD 64

  Fly    94 DGHTLCDSVAIIHYL--EETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIG---- 152
            ||..:.:|.||.:|:  ||.|      ...|...|::.:.|....|.|.|..:..|...:|    
Human    65 DGFCVFESNAIAYYVSNEELR------GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH 123

  Fly   153 KDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLV------------PQVR----N 201
            ..|:.:.|:..:.|....|:..|  ....|.||:.:::|||.:|            |..|    |
Human   124 NKQATENAKEEVRRILGLLDAYL--KTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPN 186

  Fly   202 ARRYKADLTPYPTI------VRLNQELQELDVFKATHPSTQPDCP 240
            ..|:.......|..      |:|.:::.:.|..|......:.|.|
Human   187 TNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 23/81 (28%)
maiA 35..240 CDD:273527 56/238 (24%)
GST_C_Zeta 122..236 CDD:198300 29/139 (21%)
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 23/81 (28%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 26/123 (21%)
tolA <212..>278 CDD:236545 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 2/11 (18%)
EF1G 277..381 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.