DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:215 Identity:103/215 - (47%)
Similarity:139/215 - (64%) Gaps:8/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LATKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKID 94
            :|.||||||.|.|.||.|||.|||:|||||:.:|.:||....    ..|:...||.:|||.|||:
 Worm     1 MAAKPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLLNKQK----EQEFHGNNPAEKVPILKIN 61

  Fly    95 GHTLCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQ- 158
            |.||.:|:|||.||:|..|.|.|||::|..:|:.|.|...|.|.||||||..:...:.:.:... 
 Worm    62 GLTLTESMAIIEYLDEIYPDPPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYG 126

  Fly   159 --WAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNA-RRYKADLTPYPTIVRLNQ 220
              |.||:||:||:.||::|...:|.||||:::|:|||||...|.|| .:|..|:||||.|.|::.
 Worm   127 DFWCQHFISKGFKALEELLQMHSGDFCVGNQISIADICLPSIVYNAIEKYHVDMTPYPIITRISN 191

  Fly   221 ELQELDVFKATHPSTQPDCP 240
            :|.||..|:..||:.|||.|
 Worm   192 KLAELPEFQVAHPNNQPDAP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 40/74 (54%)
maiA 35..240 CDD:273527 99/208 (48%)
GST_C_Zeta 122..236 CDD:198300 50/117 (43%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 40/74 (54%)
maiA 18..211 CDD:273527 91/196 (46%)
GST_C_Zeta 89..207 CDD:198300 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5260
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7747
Inparanoid 1 1.050 198 1.000 Inparanoid score I2488
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - mtm4732
orthoMCL 1 0.900 - - OOG6_103004
Panther 1 1.100 - - O PTHR42673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4303
SonicParanoid 1 1.000 - - X1983
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.