DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ1 and Gstz1

DIOPT Version :9

Sequence 1:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:212 Identity:130/212 - (61%)
Similarity:167/212 - (78%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ATKPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDG 95
            |.|||||||:.||||||||:|||:|.|||:|.|.:|:|. .|..:|:|::.:|||::||:|||||
Mouse     3 AGKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKD-GGQQFTEEFQTLNPMKQVPALKIDG 66

  Fly    96 HTLCDSVAIIHYLEETRPQPALLPQDPVKRAKIREIVELICSGIQPLQNVSVLDHIGKDQSLQWA 160
            .|:..|:||:.|||||||.|.||||||.|||.:|.|.:||.||||||||:|||..:|::..:|||
Mouse    67 ITIVQSLAIMEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMQWA 131

  Fly   161 QHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTPYPTIVRLNQELQEL 225
            |..|:.||..|||:|..:|||:|||||:||||:||||||.||.|:|.||:|||||..:|:||..|
Mouse   132 QKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLAL 196

  Fly   226 DVFKATHPSTQPDCPPE 242
            :||:.:||..|||.|.|
Mouse   197 EVFQVSHPRRQPDTPAE 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 43/74 (58%)
maiA 35..240 CDD:273527 125/204 (61%)
GST_C_Zeta 122..236 CDD:198300 68/113 (60%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 43/74 (58%)
maiA 7..211 CDD:273527 125/204 (61%)
Glutathione binding 14..19 4/4 (100%)