| Sequence 1: | NP_649894.1 | Gene: | GstZ1 / 41132 | FlyBaseID: | FBgn0037696 | Length: | 246 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001298275.1 | Gene: | vars1 / 114427 | ZFINID: | ZDB-GENE-010601-1 | Length: | 1271 | Species: | Danio rerio |
| Alignment Length: | 169 | Identity: | 34/169 - (20%) |
|---|---|---|---|
| Similarity: | 54/169 - (31%) | Gaps: | 70/169 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 70 VSGHAYTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYLEETRPQPALLPQD-PVKRAKIREIVE 133
Fly 134 LICSGIQPLQNVSVLD--------HIGKD---QSLQWAQHWIS-----------------RGFQG 170
Fly 171 LEKVLSHSA-----------------GKFCVGDELSMAD 192 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstZ1 | NP_649894.1 | maiA | 35..240 | CDD:273527 | 34/169 (20%) |
| vars1 | NP_001298275.1 | GST_C_ValRS_N | 80..202 | CDD:198327 | 14/73 (19%) |
| PTZ00419 | 291..1270 | CDD:240411 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||