DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and KCO3

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_199448.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:86 Identity:24/86 - (27%)
Similarity:38/86 - (44%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVVAASINLLVLRFM 248
            ||  .|||.:..:.:||:|||       |:|.....| ..|:.|::|.....||.:...|.    
plant   124 GW--LDSFCFSVMMVTTVGFG-------DRAFNTWLG-TFLAAVWLLVSTLAVARAFLFLA---- 174

  Fly   249 TMQAEDAKRDEQDAQNLAGNA 269
              .|...||:.:.|:.:.|.:
plant   175 --DARADKRNRERAKKVLGES 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301
Ion_trans_2 166..244 CDD:462301 18/59 (31%)
KCO3NP_199448.1 Ion_trans_2 106..176 CDD:462301 19/67 (28%)
FRQ1 <199..>260 CDD:444056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.