DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and kcnc4

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001182125.1 Gene:kcnc4 / 799410 ZFINID:ZDB-GENE-060503-773 Length:603 Species:Danio rerio


Alignment Length:227 Identity:45/227 - (19%)
Similarity:80/227 - (35%) Gaps:90/227 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GHSTPVTIPGKAFCMGYAMVGIPLGLVMFQSIGERLNKFASVIIRRAKRASG-----ARCTDATE 157
            ||:...::  ..||:          |::|.::|..:  ||::|. .|:|.|.     :.|.....
Zfish   349 GHTLRASV--NEFCL----------LIIFLALGVLI--FATMIY-YAERISADPDDPSGCNHTHF 398

  Fly   158 MNLMLATGMLSSIIITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKP--- 219
            .|:.:                           .|::..||:||:|:||.|           |   
Zfish   399 KNIPI---------------------------GFWWAVVTMTTLGYGDMV-----------PKTW 425

  Fly   220 -GYVALSLVFILFGLAVVAASINLLVLRF-------MTMQAEDAKRDEQDAQNLAGNAQPVTFDD 276
             |.:..:|..|. |:..:|..:.::|..|       |..|....|:.:.       |..|....|
Zfish   426 LGMIVGALCAIA-GVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKH-------NPNPGMVLD 482

  Fly   277 ESTYNMHGKLLENN--YTTENDETASLCSCTC 306
            ..::   ||...|:  .:|::|        ||
Zfish   483 SGSF---GKSESNSPRNSTQSD--------TC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 7/34 (21%)
Ion_trans_2 166..244 CDD:462301 15/81 (19%)
kcnc4NP_001182125.1 amino terminal assembly domain 1..206
Potassium_chann 1..29 CDD:431870
BTB_KCNC2_4 35..151 CDD:349722
Ion_trans 205..461 CDD:459842 32/165 (19%)
S1-S6 membrane domain 207..516 45/227 (20%)
post S6 proximal carboxyl terminal domain 517..581
distal carboxyl terminus 582..603
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.