DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and KCNK15

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_071753.2 Gene:KCNK15 / 60598 HGNCID:13814 Length:330 Species:Homo sapiens


Alignment Length:80 Identity:17/80 - (21%)
Similarity:28/80 - (35%) Gaps:27/80 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PANCKATECSRPSSPLHGKVVGS---SLTYQSVVTYSCDHGYRLVGQVQRICLAEGIWGGNEPRC 304
            |.||    ...|:...||..|.:   ..|....:|.||:...:::..:            |.|:.
Human   186 PGNC----LIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFIKVMDNL------------NLPKP 234

  Fly   305 EEI--------RCSV 311
            ::|        ||.|
Human   235 QQIDIAVPANMRCGV 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301