DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and kcnv2b

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001122212.1 Gene:kcnv2b / 567780 ZFINID:ZDB-GENE-060526-28 Length:527 Species:Danio rerio


Alignment Length:130 Identity:25/130 - (19%)
Similarity:53/130 - (40%) Gaps:48/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVCTFTYLLIGAAVFDSLESPTEAKRWEFLQTVKNNFVRKYNVTDEDFRVMEIVIIENKPHKAGP 77
            |.|.|.::.:|...|.::....|                 |:|...:|..:        ||    
Zfish   391 VGCLFLFIAMGIFTFSAMVYSVE-----------------YDVPKTNFTSI--------PH---- 426

  Fly    78 QWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAF---CMGYAMV--GIPLGLVMFQSIGERLNKFA 137
                  ::::::|.::.:|||...|.|:.|:.|   |:.:.::  |:|:.::        .|||:
Zfish   427 ------SWWWASVSISTVGYGDMYPETLLGRIFAFGCISFGIILNGLPISIL--------FNKFS 477

  Fly   138  137
            Zfish   478  477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 11/63 (17%)
Ion_trans_2 166..244 CDD:462301
kcnv2bNP_001122212.1 BTB_POZ 82..189 CDD:453885
Ion_trans 241..484 CDD:459842 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.