DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and kcns3b

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001032460.1 Gene:kcns3b / 558674 ZFINID:ZDB-GENE-051120-78 Length:424 Species:Danio rerio


Alignment Length:122 Identity:33/122 - (27%)
Similarity:55/122 - (45%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 IIRRAKRASGARCTDATEMNLMLATGMLSSIIITTGAAVFSRY-------EGWSYFDSFYYCF-- 195
            :::.|:.:.|.|....|.||.....|:| .:.||.|.:.||.:       |..|...|...|:  
Zfish   299 VLKLARHSEGMRAFGETLMNCQCEVGLL-VLFITVGISFFSTFIYYTEKEEASSQLSSIPICWWW 362

  Fly   196 --VTLTTIGFGDYVALQNDQALTNKPGYVA---LSLVFILFGLAVVAASINLLVLRF 247
              :::||:|:||...|.           ||   ::.|.||.||.|::..|.:::..|
Zfish   363 GIISMTTVGYGDVYPLT-----------VAGRIVATVCILCGLLVISLPITIIMNNF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301
Ion_trans_2 166..244 CDD:462301 25/91 (27%)
kcns3bNP_001032460.1 BTB_POZ 15..117 CDD:453885
Ion_trans 186..414 CDD:459842 33/122 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.