DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and galene

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:61/103 - (59%) Gaps:20/103 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 ITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVAL-----QNDQALTNKPGYVALSLVFILF 231
            |..||.:|:.:|.||:.||.|:||:|||||||||:|..     :::|:       :|...:::||
  Fly   632 ILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQS-------IAYCSLYLLF 689

  Fly   232 GLAVVAASINLLVLRFMTMQAEDAKR--------DEQD 261
            |:|::|.|.||:...|:....|.|:|        ||||
  Fly   690 GIALLAMSFNLVQEEFIANVKEVARRLGILKDDDDEQD 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301
Ion_trans_2 166..244 CDD:462301 32/76 (42%)
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301
Ion_trans_2 626..706 CDD:462301 32/80 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.