DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and KCNK1

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_002236.1 Gene:KCNK1 / 3775 HGNCID:6272 Length:336 Species:Homo sapiens


Alignment Length:281 Identity:78/281 - (27%)
Similarity:129/281 - (45%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVVCTFTYLLIGAAVFDSLESPTEAKRWEFLQTVKNNFVRKYNVTDED------FRVME-----I 65
            ||:....||:.||.||.|:|.|.|....:.|:.:|..|:.::....|.      .||:|     :
Human    26 LVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGV 90

  Fly    66 VIIENKPHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFCMGYAMVGIPLGLVMFQSIG 130
            .::.|.  .....|.|..|.:|::.||:..||||:.|::..|||||:.|:::|||..|:...::.
Human    91 SVLSNA--SGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVV 153

  Fly   131 ERLNKFASVIIRRAKRASGARCTDATEMNLMLATGMLSSIIIT----TGAAVFSRYE-GWSYFDS 190
            :|:...   :.||.......|...:.::..::...:|..:.::    ..|||||..| .|::.:|
Human   154 QRITVH---VTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLES 215

  Fly   191 FYYCFVTLTTIGFGDYVALQNDQALTNKPG-----------------YVALSLVFILFGLAVVAA 238
            ||:||::|:|||.||||           ||                 |:.|.|:.:|..|.....
Human   216 FYFCFISLSTIGLGDYV-----------PGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCE 269

  Fly   239 SINLLVLRFMTMQAEDAKRDE 259
            ...|...|.|....:|...|:
Human   270 LHELKKFRKMFYVKKDKDEDQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 21/58 (36%)
Ion_trans_2 166..244 CDD:462301 29/99 (29%)
KCNK1NP_002236.1 Ion_trans_2 <98..157 CDD:462301 22/58 (38%)
pore-forming domain 107..123 7/15 (47%)
Ion_trans_2 191..267 CDD:462301 27/86 (31%)
pore-forming domain 212..238 15/36 (42%)
Important for intracellular retention in recycling endosomes. /evidence=ECO:0000269|PubMed:19959478 293..299
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.