DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and KCNC2

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_631875.1 Gene:KCNC2 / 3747 HGNCID:6234 Length:638 Species:Homo sapiens


Alignment Length:164 Identity:36/164 - (21%)
Similarity:65/164 - (39%) Gaps:42/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 FYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVVAASINLLVLRF-----MTM 250
            |::..||:||:|:||    ...|..:.    :.:..:..|.|:..:|..:.::|..|     :.|
Human   428 FWWAVVTMTTLGYGD----MYPQTWSG----MLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAM 484

  Fly   251 QAEDAKRDEQDAQNLAGNAQPVTFDDESTYNMHGKLLENNYTTENDETASLCSCTCMG-GTRCLN 314
            ..:...|..:.....|..|...|| .::..||...      :|::|        ||:| ..|.|.
Human   485 AKQKLPRKRKKHIPPAPQASSPTF-CKTELNMACN------STQSD--------TCLGKDNRLLE 534

  Fly   315 HEQFV---------DPDFQPTDIIESTLCLKRAS 339
            |.:.|         :|...|.:    .|.::|:|
Human   535 HNRSVLSGDDSTGSEPPLSPPE----RLPIRRSS 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301
Ion_trans_2 166..244 CDD:462301 12/52 (23%)
KCNC2NP_631875.1 BTB_KCNC2_4 7..166 CDD:349722
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..93
Ion_trans 228..484 CDD:459842 14/63 (22%)
Selectivity filter. /evidence=ECO:0000250 437..442 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..572 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.