DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and CG1688

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster


Alignment Length:218 Identity:52/218 - (23%)
Similarity:80/218 - (36%) Gaps:87/218 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 HSTPVTIPGKAFCMGYAMVGIPLGLVMFQSIGER--------------LNKFASVIIRRAKR-AS 148
            |.||..:|         ::..||.:.  |..||.              |::...::.||..| ||
  Fly   703 HGTPSRVP---------LIASPLSVP--QDSGENTTRNTAFNRHTLQPLSRKTLLLTRRCHRHAS 756

  Fly   149 GA--------------------------------RC-----------------TDATEMNLMLAT 164
            |.                                .|                 .|..::.:.|..
  Fly   757 GTLYDSTANNTETSDDEEYMQHGSEQFVLKKLRYHCDGKDCREAEDSEEEDEKADGRQVPISLVL 821

  Fly   165 GMLSSIIITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSL--- 226
            .:|:| .|..|..:|:.:|.||..|..|:|||||:|||:||:|..::    .|.|   .|.|   
  Fly   822 LILAS-YICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARS----FNGP---ELQLYAC 878

  Fly   227 -VFILFGLAVVAASINLLVLRFM 248
             .::|.||.:||.|.::|..:.|
  Fly   879 CAYLLLGLVLVAMSFSILETQLM 901

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 9/47 (19%)
Ion_trans_2 166..244 CDD:462301 31/81 (38%)
CG1688NP_610516.1 Ion_trans_2 177..247 CDD:462301
Ion_trans_2 822..896 CDD:462301 31/81 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.