DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and Kcnv2

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001099840.1 Gene:Kcnv2 / 294065 RGDID:1309271 Length:561 Species:Rattus norvegicus


Alignment Length:95 Identity:22/95 - (23%)
Similarity:42/95 - (44%) Gaps:22/95 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AFYFSTVVLAMIGYGHSTPVTIPGKAF---CMGYAMV--GIPLGLV--MFQSIGERLNKFASVII 141
            |::::.|.::.:|||...|.|..|:.|   |:.:.::  |:|:.::  .|.....:|..:....|
  Rat   463 AWWWAAVSISTVGYGDMYPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAI 527

  Fly   142 RR---------------AKRASGARCTDAT 156
            ||               |:..||:....||
  Rat   528 RRERGKVNFMQRATKKMAECLSGSNAQSAT 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 13/55 (24%)
Ion_trans_2 166..244 CDD:462301
Kcnv2NP_001099840.1 BTB_POZ 106..213 CDD:453885
Ion_trans 275..520 CDD:459842 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.