DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and Kcnv2

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_899002.1 Gene:Kcnv2 / 240595 MGIID:2670981 Length:562 Species:Mus musculus


Alignment Length:69 Identity:17/69 - (24%)
Similarity:36/69 - (52%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AFYFSTVVLAMIGYGHSTPVTIPGKAF---CMGYAMV--GIPLGLV--MFQSIGERLNKFASVII 141
            |::::.|.::.:|||...|.|..|:.|   |:.:.::  |:|:.::  .|.....:|..:....|
Mouse   464 AWWWAAVSISTVGYGDMYPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAI 528

  Fly   142 RRAK 145
            ||.:
Mouse   529 RRER 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 13/55 (24%)
Ion_trans_2 166..244 CDD:462301
Kcnv2NP_899002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
BTB_POZ 107..214 CDD:453885
Ion_trans 276..521 CDD:459842 13/56 (23%)
Selectivity filter. /evidence=ECO:0000250 474..479 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.