DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and twk-4

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001343566.1 Gene:twk-4 / 192079 WormBaseID:WBGene00006659 Length:418 Species:Caenorhabditis elegans


Alignment Length:105 Identity:23/105 - (21%)
Similarity:37/105 - (35%) Gaps:37/105 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FAVHDGSSFSGEYDLDAEVAYNCIPGYHKFNAK------GLSISKCLLNRKNVAQWFGPDLRCKA 190
            |::.|..:.:   |:::..|.|.|......:.|      |.:|  |.   |.|:.:|.|:..   
 Worm   252 FSLRDQKTIA---DINSGGACNIIASIFSIDTKVPWFYIGCNI--CF---KKVSPYFNPETE--- 305

  Fly   191 RACPDPGDIENGLREGDTFEYPHHVKYSCNPGFLLVGSTS 230
                   :||.|             ||.|......|.:||
 Worm   306 -------EIEAG-------------KYECEKCDTFVTTTS 325

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity