DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and twk-28

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_508732.3 Gene:twk-28 / 183714 WormBaseID:WBGene00006680 Length:523 Species:Caenorhabditis elegans


Alignment Length:109 Identity:27/109 - (24%)
Similarity:38/109 - (34%) Gaps:35/109 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 WSSSQPVCRLQLKCGPPPEIPFAVHDGSSFSGEYD---LDAEVAYNCIPGYHKFNAKGLSISKCL 172
            |...|   .||...|..|    :..:|.:.|.:.|   :::||  |...|       .|..|.||
 Worm   211 WEIEQ---SLQSLTGVSP----SESNGKTMSDDEDDNQVESEV--NMFDG-------SLDGSDCL 259

  Fly   173 LNRKNVAQWFGPDLRCKARACPDPGDIENGLREGDTFEYPHHVK 216
            :.       |||.:         |.:.|..|.|....|..|.:|
 Worm   260 MG-------FGPLV---------PTERERSLMERVKKELKHELK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301 6/21 (29%)
Ion_trans_2 166..244 CDD:462301 14/51 (27%)
twk-28NP_508732.3 Ion_trans_2 <161..222 CDD:462301 4/13 (31%)
Ion_trans_2 292..370 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.