DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and egl-36

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_509795.1 Gene:egl-36 / 181269 WormBaseID:WBGene00001202 Length:558 Species:Caenorhabditis elegans


Alignment Length:155 Identity:31/155 - (20%)
Similarity:54/155 - (34%) Gaps:56/155 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 YYCFVTLTTIGFGDYVALQNDQALTNKPGYVAL--SLVFILFGLAVVAASINLLVLRFMTMQAED 254
            ::...|:||:|:||         :|....:..|  ||..:: |:..:|..:.::|..|....:.:
 Worm   398 WWAICTMTTVGYGD---------MTPHTSFGRLVGSLCAVM-GVLTIALPVPVIVSNFAMFYSHN 452

  Fly   255 AKRDE---------------------------QDAQNLAGNAQ-------PVTFD----DESTYN 281
            ..||:                           ..:|...|..|       |:..|    ||..:|
 Worm   453 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAIRRRNMPILIDQNCCDEENHN 517

  Fly   282 -MHGKLLENNYTTENDETASLCSCT 305
             .|.:..||     :||..:..|.|
 Worm   518 HKHREKSEN-----SDEGTNSSSTT 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task7NP_649891.1 Ion_trans_2 <74..133 CDD:462301
Ion_trans_2 166..244 CDD:462301 12/53 (23%)
egl-36NP_509795.1 BTB_POZ 36..147 CDD:453885
Ion_trans 203..451 CDD:459842 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.