DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task7 and Kcnc3

DIOPT Version :10

Sequence 1:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_036008594.1 Gene:Kcnc3 / 16504 MGIID:96669 Length:807 Species:Mus musculus


Alignment Length:98 Identity:22/98 - (22%)
Similarity:39/98 - (39%) Gaps:27/98 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RLNKFASV--IIRRAKRASGARCTDATEMNLMLATG--MLSSIIITTGAAVFSRY---------- 182
            |:.:|..:  |.:..:...|.|....|   |..:|.  :|..|.:..|..:|:..          
Mouse   415 RVVRFVRILRIFKLTRHFVGLRVLGHT---LRASTNEFLLLIIFLALGVLIFATMIYYAERIGAD 476

  Fly   183 ------EGWSYFDS----FYYCFVTLTTIGFGD 205
                  ...:||.:    |::..||:||:|:||
Mouse   477 PDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGD 509

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity