DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTub85D and Tubg2

DIOPT Version :9

Sequence 1:NP_524290.2 Gene:betaTub85D / 41124 FlyBaseID:FBgn0003889 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_038942746.1 Gene:Tubg2 / 680991 RGDID:1585798 Length:477 Species:Rattus norvegicus


Alignment Length:381 Identity:126/381 - (33%)
Similarity:224/381 - (58%) Gaps:22/381 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQ--SGAGNNWAKGHYTEGAELVDSVLDVVR 121
            |:|||:|:||||..:.|:.:.::.:::.|:|....:  .|||||||:| :::|.::.:.:.|::.
  Rat    86 YIPRAVLLDLEPRVIHSILNSSYAKLYNPENIYLSEHGGGAGNNWARG-FSQGEKIHEDIFDIID 149

  Fly   122 KESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPS-PKVSDTVVEPYNA 185
            :|::|.|.|:||.|.||:.||||||:|:.|:.::.:.||.:::.|:||.|: .::||.||:|||:
  Rat   150 READGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNS 214

  Fly   186 TLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL 250
            .|::.:|.:|.|....:||.||..|....|.:..|::..:|.|||..||..||.||:||.:|.||
  Rat   215 LLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDL 279

  Fly   251 RKLAVNMVPFPRLHFFMPGFAPLTSRGS-QQYRALTVPELTQQMFDAKNMMAACDPRHGR----- 309
            ..|..:::|.|||||.|.|:.|||:..| ...|..||.::.:::...||:|.:.    ||     
  Rat   280 IGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVST----GRDRQTN 340

  Fly   310 --YLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAV---CDIPPRGLKMSATFIG 369
              |:.:..|.:|.:...:|.:.:..|:.:..:.|:.|.|.:.:.|:   ....|...::|...:.
  Rat   341 HCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMA 405

  Fly   370 NSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESN---MNDLVSEY 422
            |.|:|..||:...:|:..:::|.|||..:..|.:.:..|.|.:.:   :.:|:.||
  Rat   406 NHTSISSLFESSCQQYDKLWKRGAFLEQFRKEDIFKDNFEEMDRSREVVQELIDEY 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTub85DNP_524290.2 PLN00220 1..430 CDD:215107 126/381 (33%)
Tubg2XP_038942746.1 gamma_tubulin 81..461 CDD:276957 124/379 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.