DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8135 and Lmbrd2

DIOPT Version :10

Sequence 1:NP_649890.1 Gene:CG8135 / 41123 FlyBaseID:FBgn0037689 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_796152.2 Gene:Lmbrd2 / 320506 MGIID:2444173 Length:694 Species:Mus musculus


Alignment Length:40 Identity:10/40 - (25%)
Similarity:18/40 - (45%) Gaps:6/40 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KQLEIEASSLRRVALVGVAVSFTATLVCVIAAPMLYNYMQ 44
            ||||...:..:.:..:..||:      .|:.:.:|..|.|
Mouse   277 KQLERGCAQKKDILSILTAVN------GVVGSKILQGYKQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8135NP_649890.1 LMBR1 1..543 CDD:461429 10/40 (25%)
Lmbrd2NP_796152.2 LMBR1 22..549 CDD:461429 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..638
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..680
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.