DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9356 and R12B2.2

DIOPT Version :9

Sequence 1:NP_649889.1 Gene:CG9356 / 41122 FlyBaseID:FBgn0037688 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_498255.2 Gene:R12B2.2 / 187835 WormBaseID:WBGene00020018 Length:281 Species:Caenorhabditis elegans


Alignment Length:220 Identity:66/220 - (30%)
Similarity:100/220 - (45%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ELVQMRPRLVTSADSLPEHK-KTKAPKFVPYEPYPGAV-------------NPMISEPTNKHKIH 158
            |.|....|.....:|.||.| |.|..:.||:|||..||             ..:|:...|...  
 Worm    21 EEVHFTKRAEEDGNSSPESKGKIKKTRIVPWEPYKAAVAHDKQGSTCPENLPELIAYAMNSKS-- 83

  Fly   159 RDKNNLDIAVLVDQVSTLRTQELETETTDIKETDTASSHEVNS-LKEELAKMRDERNYFQAQYKF 222
            ...||:.:           .:||..|..|.|..:..:|.|..: |:.||..:|.|.|       .
 Worm    84 EQNNNIQL-----------RKELRDERKDRKSMEPVTSSEREAELERELDLLRKELN-------I 130

  Fly   223 QTQVNSELKSLLVASVGEDLQTRVNLLTEDKLQLARALLDTANNLTTHTEQIEFLAGQCEVWRSK 287
            :.::|||||.|::|::.::||.:|..|||||::||..:.:....|....|:.:.|....:||:.|
 Worm   131 EQKMNSELKRLMIATLSDELQGQVEALTEDKVRLAHRVDEYMGKLMVEDEESDRLRIDRDVWKCK 195

  Fly   288 FLASSVMVEELARWKADLTQKNQLL 312
            |||.|:..:|       ||.||:.|
 Worm   196 FLAQSIRCDE-------LTSKNEYL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9356NP_649889.1 SMC_prok_B <156..>333 CDD:274008 48/158 (30%)
R12B2.2NP_498255.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006490
OrthoInspector 1 1.000 - - oto19607
orthoMCL 1 0.900 - - OOG6_126481
Panther 1 1.100 - - LDO PTHR13066
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.