DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and yobB

DIOPT Version :10

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_416357.1 Gene:yobB / 948329 ECOCYCID:G7015 Length:218 Species:Escherichia coli


Alignment Length:86 Identity:22/86 - (25%)
Similarity:38/86 - (44%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LPECFNAPY--GTKYFREYSETIPDGYTSQQLSNLARKHQVYIVGGTIPELGENDAIYNTCTVWS 108
            ||..:|..:  |...|..:.:| |..|.....:.|.|:.:...|....|:..:.|.   ||::::
E. coli    84 LPVEYNDRFIRGIAVFAPWRKT-PGIYHQSHGACLGRRSRTITVVDEQPQGMDMDP---TCSLFT 144

  Fly   109 PTG------DLVAKHRKMHLF 123
             ||      ||:|..|::..|
E. coli   145 -TGQCLGEPDLLASARRLQFF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 22/86 (26%)
yobBNP_416357.1 CN_hydrolase 5..211 CDD:425873 22/86 (26%)

Return to query results.
Submit another query.