DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8132 and NIT1

DIOPT Version :9

Sequence 1:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_012102.1 Gene:NIT1 / 854642 SGDID:S000001426 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:45/204 - (22%)
Similarity:71/204 - (34%) Gaps:47/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECFNAPY----------------GTKY 58
            :|.||:........:....:...|..:||...:|:.:||.....|                |.:.
Yeast     6 VAALQIGSCPGSTKDTLKKILSYEKEIKESGAKLVVIPEATLGGYPKGSNFGVYLGYRLQEGREE 70

  Fly    59 FREY-SETIPDGYTSQ-----QLSNLARKHQVYIVGGTIPELGENDAIYNTCTVWSPTGDLVAKH 117
            :.:| :|.|..|...:     ||..|::.....:..|.|..  :...:|.|.....|....|.||
Yeast    71 YAKYLAEAIEIGNGEKYPEISQLCALSKATDASLCVGCIER--DGTTLYCTMVYIDPKDGYVGKH 133

  Fly   118 RKMHLFDIDVKGGIRFKESETL----SAGNDFTIINVDGHKIGIGICYDIRFEEMARLYRNA--- 175
            ||:    :...|       |.|    ..|:...:::....|||..||:    |.|..|.|.|   
Yeast   134 RKL----MPTAG-------ERLIWGQGDGSTLPVVDTAAGKIGGAICW----ENMMPLLRYAMYK 183

  Fly   176 -GCEMIIYP 183
             |.|:...|
Yeast   184 KGVEIWCAP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8132NP_649888.1 nit 9..272 CDD:143596 45/204 (22%)
NIT1NP_012102.1 nitrilase 4..>198 CDD:416265 45/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.